Antibodies

Jump to Filters
View as table Download
C10orf131 Rabbit Polyclonal Antibody
TA330849

USD 375.00

5 Days

Rabbit Polyclonal Anti-C10orf131 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-C10orf131 antibody is: synthetic peptide directed towards the middle region of Human C10orf131. Synthetic peptide located within the following region: EEEEFMKEFILTDILKVKAADYEDDQEQIKKQKANIFVPSSSPVVNQRKL
CC2D2B Rabbit Polyclonal Antibody
TA359040

USD 360.00

5 Days

CC2D2B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CC2D2B