Germany
Japan
United Kingdom
China
CCBE1 rabbit polyclonal antibody, Purified
| Applications | IF, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant Human ccbe1 (Cys159-Leu251) derived from E. coli. |
Antibodies
View as table Download
CCBE1 rabbit polyclonal antibody, Purified
| Applications | IF, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant Human ccbe1 (Cys159-Leu251) derived from E. coli. |
Rabbit Polyclonal Anti-CCBE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCBE1 antibody: synthetic peptide directed towards the middle region of human CCBE1. Synthetic peptide located within the following region: PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD |
Rabbit Polyclonal Anti-Ccbe1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ccbe1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRTHSSAEDFP |
Active filters
Target Symbol
- CCBE1