Antibodies

Jump to Filters
View as table Download
CCDC117 Rabbit Polyclonal Antibody
TA337783

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCDC117 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCDC117 antibody: synthetic peptide directed towards the middle region of human CCDC117. Synthetic peptide located within the following region: DTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNT
CCDC117 Rabbit Polyclonal Antibody
TA357098

USD 360.00

5 Days

CCDC117 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated