CCDC17 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 439-477 amino acids from the C-terminal region of human CCDC17 |
CCDC17 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 439-477 amino acids from the C-terminal region of human CCDC17 |
Rabbit Polyclonal Anti-CCDC17 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CCDC17 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC17. Synthetic peptide located within the following region: ARIQELQAEPGNPLSSRREAELYSPVQKANPGTLAAEIRALREAYIRDGG |