Antibodies

Jump to Filters
View as table Download
LEC (CCL16) Goat Polyclonal Antibody
TA328365

USD 285.00

5 Days

Anti-Human LEC Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human LEC (CCL16)
LEC (CCL16) Goat Polyclonal Antibody
TA328364

USD 285.00

5 Days

Biotinylated Anti-Human LEC Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human LEC (CCL16)
LEC (CCL16) Rabbit Polyclonal Antibody
TA329182

USD 375.00

5 Days

Rabbit Polyclonal anti-CCL16 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL16 antibody: synthetic peptide directed towards the N terminal of human CCL16. Synthetic peptide located within the following region: SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL
LEC (CCL16) Rabbit Polyclonal Antibody
TA351037

USD 345.00

In Stock

Rabbit Polyclonal Anti-CCL16 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL16
CCL16 Rabbit Polyclonal Antibody
TA366994

USD 380.00

4 Weeks

CCL16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL16
CCL16 Rabbit Polyclonal Antibody
TA368118

USD 380.00

4 Weeks

CCL16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL16
LEC (CCL16) Rabbit Polyclonal Antibody
TA374352

USD 220.00

3 Weeks

CCL16 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CCL16 (NP_004581.1).
Modifications Unmodified