Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CCL5 / RANTES Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CCL5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCL5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CCL5 |
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CCL5