Antibodies

Jump to Filters
View as table Download
MCP2 (CCL8) Mouse Monoclonal Antibody
TA316598

USD 425.00

In Stock

MCP-2 / CCL8 Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
MCP2 (CCL8) Rabbit Polyclonal Antibody
TA328377

USD 285.00

5 Days

Anti-Human MCP-2 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MCP-2 (CCL8)
MCP2 (CCL8) Rabbit Polyclonal Antibody
TA328376

USD 285.00

5 Days

Biotinylated Anti-Human MCP-2 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MCP-2 (CCL8)
MCP2 (CCL8) Rabbit Polyclonal Antibody
TA330381

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCL8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL8 antibody: synthetic peptide directed towards the middle region of human CCL8. Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
CCL8 Rabbit Polyclonal Antibody
TA366824

USD 380.00

4 Weeks

CCL8 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL8