Germany
Japan
United Kingdom
China
CCN1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CCN1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CYR61 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYR61 antibody is: synthetic peptide directed towards the middle region of Human CYR61. Synthetic peptide located within the following region: CEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPR |
Rabbit Polyclonal Anti-CYR61 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYR61 |
CCN1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CCN1 |
Active filters
Target Symbol
- CCN1