Cyclin (CCNI) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 301-331 amino acids from the C-terminal region of human CCNI. |
Cyclin (CCNI) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 301-331 amino acids from the C-terminal region of human CCNI. |
Rabbit Polyclonal Anti-Ccni Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Ccni antibody is: synthetic peptide directed towards the N-terminal region of Rat Ccni. Synthetic peptide located within the following region: MKFPGPLENQRLSSLLERAISREAQMWKVNVPKIPTNQNVSPSQRDEVIQ |
Carrier-free (BSA/glycerol-free) CCNI mouse monoclonal antibody,clone OTI4D10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCNI mouse monoclonal antibody,clone OTI3F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CCNI Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CCNI |
CCNI rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CCNI |
CCNI rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CCNI |
Cyclin I Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
CCNI mouse monoclonal antibody,clone OTI4D10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI4D10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI4D10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CCNI mouse monoclonal antibody,clone OTI4D10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CCNI mouse monoclonal antibody,clone OTI3F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI3F10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI3F10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CCNI mouse monoclonal antibody,clone OTI3F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |