Cyclin (CCNI) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 301-331 amino acids from the C-terminal region of human CCNI. |
Cyclin (CCNI) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 301-331 amino acids from the C-terminal region of human CCNI. |
Rabbit Polyclonal Anti-Ccni Antibody
Applications | WB |
Reactivities | Rat |
Immunogen | The immunogen for anti-Ccni antibody is: synthetic peptide directed towards the N-terminal region of Rat Ccni. Synthetic peptide located within the following region: MKFPGPLENQRLSSLLERAISREAQMWKVNVPKIPTNQNVSPSQRDEVIQ |
Carrier-free (BSA/glycerol-free) CCNI mouse monoclonal antibody,clone OTI4D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCNI mouse monoclonal antibody,clone OTI3F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CCNI Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CCNI |
CCNI rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCNI |
CCNI rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCNI |
Cyclin I Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 257-377 of human Cyclin I (NP_006826.1). |
Modifications | Unmodified |
CCNI mouse monoclonal antibody,clone OTI4D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI4D10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI4D10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CCNI mouse monoclonal antibody,clone OTI4D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CCNI mouse monoclonal antibody,clone OTI3F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI3F10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CCNI mouse monoclonal antibody,clone OTI3F10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CCNI mouse monoclonal antibody,clone OTI3F10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |