Antibodies

View as table Download

CCR4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR4

CCR4 mouse monoclonal antibody, clone KH-4F5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

CCR4 (Extracell. Dom.) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic corresponding to Human CCR4 extracellular domain.
Epitope: Extracellular Domain.

CCR4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%).

Rabbit Polyclonal Anti-CCR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL

CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Conjugation Unconjugated
Immunogen CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%).

Mouse anti-CCR4 monoclonal antibody

Applications IF
Reactivities Human
Conjugation Unconjugated

CCR4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Human, Mouse
Immunogen Synthetic peptide surrounding amino acid 32 of human CCR4

CCR4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR4

CCR4 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-CCR4 (Clone KW-0761 (Mogamulizumab))

Reactivities Human
Conjugation Unconjugated
Modifications This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CCR4 (Clone KW-0761 (Mogamulizumab))

Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques.