Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CCR4 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%). |
Rabbit Polyclonal Anti-CCR4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL |
CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%). |
Mouse anti-CCR4 monoclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCR4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acid 32 of human CCR4 |
CCR4 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-CCR4 (Clone KW-0761 (Mogamulizumab))
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CCR4 (Clone KW-0761 (Mogamulizumab))
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- CCR4
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)