Germany
Japan
United Kingdom
China
CCRL2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 205-234 amino acids from the Central region of human CCRL2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CCRL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCRL2 antibody: synthetic peptide directed towards the N terminal of human CCRL2. Synthetic peptide located within the following region: LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL |
Recombinant Anti-CCRL2 (Clone BZ5B8)
| Applications | ELISA, FC, ICC, IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CCRL2 (Clone BZ5B8)
| Applications | ELISA, FC, ICC, IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Recombinant Anti-CCRL2 (Clone BZ2E3)
| Applications | ELISA, FC, ICC, IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CCRL2 (Clone BZ2E3)
| Applications | ELISA, FC, ICC, IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CCRL2