Germany
Japan
United Kingdom
China
CD200 (OX-2 Antigen), rat anti mouse, clone OX-90
| Applications | ELISA, IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP |
Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: PRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTD |
CD200 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD200 |
CD200 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- CD200