Antibodies

Jump to Filters
View as table Download
CD300C Rabbit Polyclonal Antibody
TA338125

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD300C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD300C antibody is: synthetic peptide directed towards the C-terminal region of Human CD300C. Synthetic peptide located within the following region: MGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLL
CD300C Rabbit Polyclonal Antibody
TA374436

USD 220.00

3 Weeks

CD300C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1).
Modifications Unmodified