Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD82 mouse monoclonal antibody, clone B-L2, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD82 mouse monoclonal antibody, clone B-L2, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD82 mouse monoclonal antibody, clone B-L2, PE
| Applications | FC |
| Conjugation | PE |
CD82 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human CD82 |
Rabbit anti-CD82 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD82 |
Rabbit Polyclonal Anti-CD82 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD82 antibody is: synthetic peptide directed towards the middle region of CD82. Synthetic peptide located within the following region: ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY |
CD82 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CD82