Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse monoclonal CDA Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CDA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDA antibody: synthetic peptide directed towards the C terminal of human CDA. Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ |
Mouse monoclonal CDA Antibody (Center)(Ascites)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CDA rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDA |
CDA Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human CDA (NP_001776.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CDA