Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CDH23 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDH23. |
Goat Anti-CDH23 / USH1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YNISLYENVTVGTS, from the internal region of the protein sequence according to NP_071407.3; NP_443068.1. |
Rabbit Polyclonal Anti-CDH23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDH23 antibody is: synthetic peptide directed towards the N-terminal region of Human CDH23. Synthetic peptide located within the following region: DHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATD |
Rabbit Polyclonal Anti-CDH23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDH23 antibody: synthetic peptide directed towards the middle region of human CDH23. Synthetic peptide located within the following region: DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI |
Anti-CDH23 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cadherin-related 23cadherin-related 23 |
CDH23 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-270 of human CDH23 (NP_001165402.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CDH23