Rabbit anti-CDK4 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-CDK4 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
CDK4 mouse monoclonal antibody, clone IML-4, Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit polyclonal anti-R Cdk4 antibody (C-term)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | This Rat Cdk4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 272-303 amino acids from the C-terminal region of rat Cdk4. |
Rabbit Polyclonal Anti-CDK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4. Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Mouse Monoclonal CDK4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal CDK4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CDK4 Antibody - C-terminal region
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CDK4 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of rat CDK4 |
CDK4 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDK4 |
CDK4 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Phospho-CDK4-T172 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Phospho T172 |
CDK4 Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
CDK4 Rabbit monoclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CDK4 Rabbit monoclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |