Antibodies

View as table Download

CDK7 mouse monoclonal antibody, clone MO-1.1, Aff - Purified

Applications FC, IF, IHC, IP, WB

Rabbit Polyclonal Anti-CDK7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK7 Antibody: A synthesized peptide derived from human CDK7

Goat Polyclonal Anti-CDK7 (aa47-58) Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDK7 (aa47-58) Antibody: Peptide with sequence C-HRSEAKDGINRT, from the internal region of the protein sequence according to NP_001790.1.

CDK7 mouse monoclonal antibody, clone IMD-26, Purified

Applications IF, IHC, WB
Reactivities Human

Rabbit polyclonal Phospho-CDK7(T170) Antibody

Applications Dot, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7.
Modifications Phospho-specific

Rabbit polyclonal anti-CDK7 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CDK7.

Rabbit Polyclonal Anti-CDK7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Rabbit Polyclonal Anti-CDK7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Rabbit Polyclonal anti-CDK7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDK7 antibody is: synthetic peptide directed towards the N-terminal region of Human CDK7. Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG

Rabbit Polyclonal Anti-CDK7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the middle region of human CDK7. Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE

Anti-CDK7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 12-295 amino acids of human

CDK7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-346 of human CDK7 (NP_001790.1).
Modifications Unmodified

CDK7 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified