CDK7 mouse monoclonal antibody, clone MO-1.1, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
CDK7 mouse monoclonal antibody, clone MO-1.1, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 Antibody: A synthesized peptide derived from human CDK7 |
Goat Polyclonal Anti-CDK7 (aa47-58) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 (aa47-58) Antibody: Peptide with sequence C-HRSEAKDGINRT, from the internal region of the protein sequence according to NP_001790.1. |
CDK7 mouse monoclonal antibody, clone IMD-26, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal Phospho-CDK7(T170) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CDK7 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CDK7. |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 antibody is: synthetic peptide directed towards the N-terminal region of Human CDK7. Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the middle region of human CDK7. Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE |
Anti-CDK7 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 12-295 amino acids of human |
CDK7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-346 of human CDK7 (NP_001790.1). |
| Modifications | Unmodified |
CDK7 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |