Rabbit Polyclonal Anti-CDK8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK8 antibody: synthetic peptide directed towards the C terminal of human CDK8. Synthetic peptide located within the following region: GLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY |
Rabbit Polyclonal anti-RGD1560888 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-RGD1560888 antibody is: synthetic peptide directed towards the N-terminal region of Rat RGD1560888. Synthetic peptide located within the following region: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA |
Rabbit anti Cdk8 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human cdk8 protein. This sequence is identical to human, mouse and rat. |
Rabbit Polyclonal Anti-CDK8 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDK8 |
Germany
Japan
United Kingdom
China
