Antibodies

Jump to Filters
View as table Download
CDR2 Rabbit Polyclonal Antibody
TA309603

USD 424.00

In Stock

Rabbit Polyclonal CDR2 Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human protein. [Swiss-prot# Q01850]
CDR2 Mouse Monoclonal Antibody [Clone ID: 33]
TA336894

USD 410.00

5 Days

Mouse Monoclonal CDR2 Antibody (33)

Applications IHC, WB
Reactivities Human, Mouse (Negative)
Conjugation Unconjugated
CDR2 Rabbit Polyclonal Antibody
TA339869

USD 310.00

5 Days

Rabbit Polyclonal Anti-CDR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDR2 antibody: synthetic peptide directed towards the N terminal of human CDR2. Synthetic peptide located within the following region: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ
CDR2 Rabbit Polyclonal Antibody
TA349788

USD 345.00

In Stock

Rabbit Polyclonal Anti-CDR2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CDR2
CDR2 Rabbit Polyclonal Antibody
TA369034

USD 380.00

4 Weeks

CDR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CDR2