Antibodies

Jump to Filters
View as table Download
CDS2 Rabbit Polyclonal Antibody
TA339380

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA
CDS2 Rabbit Polyclonal Antibody
TA374595

USD 220.00

3 Weeks

CDS2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDS2 (NP_003809.1).
Modifications Unmodified