Germany
Japan
United Kingdom
China
CDT1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDT1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDT1 antibody: synthetic peptide directed towards the C terminal of human CDT1. Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ |
Goat Polyclonal Antibody against CDT1 / Dup
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ARLAHQTRAEEGL, from the C Terminus of the protein sequence according to NP_112190.1. |
CDT1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDT1 |
CDT1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human CDT1 |
Active filters
Target Symbol
- CDT1