Rabbit Polyclonal Anti-CEACAM6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CEACAM6 antibody: synthetic peptide directed towards the middle region of human CEACAM6. Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP |
Rabbit Polyclonal Anti-CEACAM6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CEACAM6 antibody: synthetic peptide directed towards the N terminal of human CEACAM6. Synthetic peptide located within the following region: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI |
CEACAM6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-320 of human CEACAM6 (NP_002474.4). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
