Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CEBP gamma (CEBPG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 83-110 amino acids from the C-terminal region of human CEBPG |
Rabbit Polyclonal Anti-CEBPG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CEBPG antibody: synthetic peptide directed towards the middle region of human CEBPG. Synthetic peptide located within the following region: RNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD |
Rabbit Polyclonal Anti-CEBPG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CEBPG antibody: synthetic peptide directed towards the N terminal of human CEBPG. Synthetic peptide located within the following region: PGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR |
Anti-CEBPG Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CEBPG Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CEBPG (NP_001797.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CEBPG