Antibodies

View as table Download

Rabbit polyclonal anti-CENPA antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CENPA.

Mouse monoclonal CENP-A Antibody

Applications WB
Reactivities Human. Other species not yet tested
Conjugation Unconjugated

Rabbit Polyclonal Anti-CENPA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENPA antibody: synthetic peptide directed towards the N terminal of human CENPA. Synthetic peptide located within the following region: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE

Rabbit Polyclonal Anti-CENPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENPA antibody: synthetic peptide directed towards the middle region of human CENPA. Synthetic peptide located within the following region: ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Rabbit polyclonal Centromeric Protein A (Ser7) antibody(Phospho-specific)

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Centromeric Protein A around the phosphorylation site of serine 7 (R-R-SP-R-K).
Modifications Phospho-specific

CENPA Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1).