Rabbit Polyclonal CENPW Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CENPW antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CENPW. |
Rabbit Polyclonal CENPW Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CENPW antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CENPW. |
Rabbit Polyclonal Anti-CENPW Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CENPW antibody: synthetic peptide directed towards the N terminal of human CENPW. Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV |