Antibodies

View as table Download

Rabbit Polyclonal CENPW Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CENPW antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CENPW.

Rabbit Polyclonal Anti-CENPW Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENPW antibody: synthetic peptide directed towards the N terminal of human CENPW. Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV