Antibodies

Jump to Filters
View as table Download
CEP120 Rabbit Polyclonal Antibody
TA331314

USD 375.00

5 Days

Rabbit Polyclonal Anti-CEP120 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CEP120 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP120. Synthetic peptide located within the following region: QHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLS
CEP120 Rabbit Polyclonal Antibody
TA374643

USD 220.00

3 Weeks

CEP120 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CEP120 (NP_694955.2).
Modifications Unmodified