Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CEP89 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CEP89 Antibody is: synthetic peptide directed towards the N-terminal region of Human CEP89. Synthetic peptide located within the following region: PNPSPERPRSALAAAILATTLTGRTVAIPQPRQRSRSESDVSSVEQDSFI |
Rabbit Polyclonal Anti-CEP89 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CEP89 Antibody is: synthetic peptide directed towards the N-terminal region of Human CEP89. Synthetic peptide located within the following region: DRGGHSDDLYAVPHRNQVPLLHEVNSEDDENISHQDGFPGSPPAPQRTQQ |
CEP89 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CCDC123 |
CEP89 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CEP89 |
CEP89 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CEP89 |
Active filters
Target Symbol
- CEP89