Antibodies

View as table Download

LOC100736962 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Esterase is isolated and purified from Porcine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LOC100736962 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Esterase is isolated and purified from Porcine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LOC100736962 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Esterase is isolated and purified from Porcine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Goat Polyclonal Antibody against CES1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NTQAAQKLKDKE, from the internal region (near C terminus) of the protein sequence according to NP_001020366.1; NP_001020365.1; NP_001257.4.

Rabbit Polyclonal Anti-CES1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES1 antibody: synthetic peptide directed towards the N terminal of human CES1. Synthetic peptide located within the following region: VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS

LOC100736962 rabbit polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Porcine
Immunogen Esterase from Porcine Liver.

Rabbit anti-CES1 Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-CES1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES1 antibody: synthetic peptide directed towards the C terminal of human CES1. Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL

LOC100736962 rabbit polyclonal antibody, HRP, Purified

Applications ELISA, WB
Reactivities Porcine
Conjugation HRP
Immunogen Esterase from porcine liver

CES1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CES1

CES1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CES1