LOC100736962 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Immunogen | Esterase is isolated and purified from Porcine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
LOC100736962 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Esterase is isolated and purified from Porcine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
LOC100736962 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Immunogen | Esterase is isolated and purified from Porcine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Goat Polyclonal Antibody against CES1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NTQAAQKLKDKE, from the internal region (near C terminus) of the protein sequence according to NP_001020366.1; NP_001020365.1; NP_001257.4. |
Rabbit Polyclonal Anti-CES1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CES1 antibody: synthetic peptide directed towards the N terminal of human CES1. Synthetic peptide located within the following region: VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS |
LOC100736962 rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Porcine |
| Immunogen | Esterase from Porcine Liver. |
Rabbit anti-CES1 Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CES1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CES1 antibody: synthetic peptide directed towards the C terminal of human CES1. Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL |
LOC100736962 rabbit polyclonal antibody, HRP, Purified
| Applications | ELISA, WB |
| Reactivities | Porcine |
| Conjugation | HRP |
| Immunogen | Esterase from porcine liver |
CES1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CES1 |
Germany
Japan
United Kingdom
China
