Antibodies

Jump to Filters
View as table Download
CFAP97D1 Rabbit Polyclonal Antibody
TA334845

USD 375.00

5 Days

Rabbit Polyclonal Anti-C17orf105 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C17orf105 antibody is: synthetic peptide directed towards the middle region of Human C17orf105. Synthetic peptide located within the following region: QLCQKIANAHRGPAKVDCWNEYFSKSLNRETRNRELVRITMENQGILKRL