Factor D (CFD) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 75-107 amino acids from the N-terminal region of Human CFD |
Factor D (CFD) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 75-107 amino acids from the N-terminal region of Human CFD |
Rabbit polyclonal anti-CFD (Adipsin) antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 232 of mouse Adipsin |
Rabbit Polyclonal Anti-CFD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CFD antibody: synthetic peptide directed towards the C terminal of human CFD. Synthetic peptide located within the following region: GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG |
CFD Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-253 of human CFD (NP_001919.2). |
Modifications | Unmodified |