CGGBP1 mouse monoclonal antibody, clone 1D11
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
CGGBP1 mouse monoclonal antibody, clone 1D11
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-CGGBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CGGBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human CGGBP1. Synthetic peptide located within the following region: GGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLT |
CGGBP1 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | Unmodified |