Antibodies

Jump to Filters
View as table Download
CGGBP1 Mouse Monoclonal Antibody [Clone ID: 1D11]
AM20960PU-N

USD 480.00

2 Weeks

CGGBP1 mouse monoclonal antibody, clone 1D11

Applications ELISA, IF, IHC, WB
Reactivities Human
CGGBP1 Rabbit Polyclonal Antibody
TA338345

USD 375.00

5 Days

Rabbit Polyclonal Anti-CGGBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CGGBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human CGGBP1. Synthetic peptide located within the following region: GGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLT
CGGBP1 Rabbit Polyclonal Antibody
TA374695

USD 220.00

3 Weeks

CGGBP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CGGBP1 (NP_003654.3).
Modifications Unmodified