Antibodies

Jump to Filters
View as table Download
CH25H Rabbit Polyclonal Antibody
TA338198

USD 375.00

5 Days

Rabbit Polyclonal Anti-CH25H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CH25H antibody is: synthetic peptide directed towards the C-terminal region of Human CH25H. Synthetic peptide located within the following region: VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH