Antibodies

Jump to Filters
View as table Download
CHCHD6 Rabbit Polyclonal Antibody
TA320046

USD 430.00

5 Days

Rabbit Polyclonal CHCHD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Rabbit polyclonal CHCHD6 antibody was raised against a 17 amino acid peptide near the amino terminus of human CHCHD6.
CHCHD6 Rabbit Polyclonal Antibody
TA342947

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHCHD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHCHD6 antibody: synthetic peptide directed towards the N terminal of human CHCHD6. Synthetic peptide located within the following region: LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA
CHCHD6 Rabbit Polyclonal Antibody
TA342948

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHCHD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHCHD6 antibody: synthetic peptide directed towards the middle region of human CHCHD6. Synthetic peptide located within the following region: AAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARELESR
CHCHD6 Rabbit Polyclonal Antibody
TA374710

USD 410.00

3 Weeks

CHCHD6 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified