Rabbit Polyclonal Anti-CHERP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHERP antibody: synthetic peptide directed towards the middle region of human CHERP. Synthetic peptide located within the following region: SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR |
Rabbit Polyclonal Anti-CHERP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHERP antibody: synthetic peptide directed towards the middle region of human CHERP. Synthetic peptide located within the following region: EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD |
CHERP rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHERP |
CHERP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
