Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CHI3L1 Antibody
| Applications | IF, WB |
| Reactivities | Human, SimianIVE |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL |
CHI3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
YKL-40/CHI3L1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human YKL-40/CHI3L1 (NP_001267.2). |
| Modifications | Unmodified |
YKL-40/CHI3L1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human YKL-40/CHI3L1 (NP_001267.2). |
| Modifications | Unmodified |
YKL-40/CHI3L1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human YKL-40/CHI3L1 (NP_001267.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHI3L1