Rabbit Polyclonal Anti-CHIC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI |
CHIC2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide from the C-terminal region (between 145-173 aa) of Human CHIC2. |
Rabbit Polyclonal Anti-CHIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESE |
CHIC2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CHIC2 (NP_036242.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
