Antibodies

View as table Download

Rabbit Polyclonal Anti-CHID1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CHID1 antibody is: synthetic peptide directed towards the N-terminal region of Human CHID1. Synthetic peptide located within the following region: CSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLE

Rabbit Polyclonal Anti-CHID1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CHID1 antibody is: synthetic peptide directed towards the N-terminal region of Human CHID1. Synthetic peptide located within the following region: HTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSY

CHID1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-393 of human CHID1 (NP_076436.3).
Modifications Unmodified