Antibodies

Jump to Filters
View as table Download
CHMP1B Rabbit Polyclonal Antibody
TA344782

USD 475.00

5 Days

Rabbit Polyclonal Anti-CHMP1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHMP1B antibody: synthetic peptide directed towards the N terminal of human CHMP1B. Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT
CHMP1B Rabbit Polyclonal Antibody
TA374746

USD 220.00

3 Weeks

CHMP1B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human CHMP1B (NP_065145.2).
Modifications Unmodified