Rabbit anti-CHMP2B Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHMP2B |
Rabbit anti-CHMP2B Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHMP2B |
Rabbit Polyclonal Anti-Chmp2b Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Chmp2b antibody is: synthetic peptide directed towards the N-terminal region of Rat Chmp2b. Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK |
CHMP2B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHMP2B |
CHMP2B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHMP2B |
CHMP2B Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Unmodified |