Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
Rabbit polyclonal anti-CHP antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CHP. |
USD 465.00
4 Weeks
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CHP mouse monoclonal antibody,clone OTI2E2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CHP1 mouse monoclonal antibody,clone OTI6F5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
CHP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CHP1 |
CHP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human CHP1 (NP_009167.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
CHP mouse monoclonal antibody,clone OTI2E2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI2E2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI2E2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
CHP mouse monoclonal antibody,clone OTI2E2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
CHP1 mouse monoclonal antibody,clone OTI6F5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHP1 mouse monoclonal antibody,clone OTI6F5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CHP1 mouse monoclonal antibody,clone OTI6F5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
CHP1 mouse monoclonal antibody,clone OTI6F5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- CHP1
Filter by
Category
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Alzheimer's disease (28)
- Amyotrophic lateral sclerosis (ALS) (28)
- Apoptosis (28)
- Axon guidance (28)
- B cell receptor signaling pathway (28)
- Calcium signaling pathway (28)
- Long-term potentiation (28)
- MAPK signaling pathway (28)
- Natural killer cell mediated cytotoxicity (28)
- Oocyte meiosis (28)
- T cell receptor signaling pathway (28)
- VEGF signaling pathway (28)
- Wnt signaling pathway (28)