Antibodies

View as table Download

CHRDL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRDL2

Rabbit Polyclonal Anti-CHRDL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human CHRDL2. Synthetic peptide located within the following region: CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH

Rabbit Polyclonal Anti-CHRDL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRDL2