Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CHRNA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA9 antibody: synthetic peptide directed towards the N terminal of human CHRNA9. Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE |
CHRNA9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CHRNA9 antibody is: synthetic peptide directed towards the N-terminal region of Human ACHA9 |
CHRNA9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-240 of human CHRNA9 (NP_060051.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHRNA9