Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein. |
CIITA (N-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CIITA. |
Rabbit Polyclonal Anti-CIITA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIITA antibody: synthetic peptide directed towards the middle region of human CIITA. Synthetic peptide located within the following region: YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR |
CIITA rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-Ciita Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN |
Carrier-free (BSA/glycerol-free) CIITA mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CIITA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CIITA (NP_000237.2). |
| Modifications | Unmodified |
CIITA mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CIITA mouse monoclonal antibody,clone OTI7B12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CIITA mouse monoclonal antibody,clone OTI7B12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CIITA mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CIITA