Rabbit Polyclonal Anti-CIRBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIRBP antibody: synthetic peptide directed towards the N terminal of human CIRBP. Synthetic peptide located within the following region: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG |
Rabbit Polyclonal Anti-CIRBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIRBP antibody: synthetic peptide directed towards the middle region of human CIRBP. Synthetic peptide located within the following region: GYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHN |
Goat Anti-CIRBP (aa 161-172) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDSYDSYATHNE, from the C Terminus of the protein sequence according to NP_001271.1. |
CIRBP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human CIRBP |
CIRBP rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CIRBP Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CIRBP (NP_001271.1). |
| Modifications | Unmodified |
CIRBP Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CIRBP (NP_001271.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
