Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CITED2 antibody (NT)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CITED2 antibody was raised against an 18 amino acid peptide near the amino terminus of human CITED2. |
Rabbit Polyclonal Anti-CITED2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: HIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVA |
Rabbit Polyclonal Anti-CITED2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: ADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNAL |
CITED2 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CITED2 |
CITED2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CITED2 |
CITED2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human CITED2 (NP_001161861.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CITED2