Rabbit Polyclonal Anti-CLASP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLASP2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CLASP2. Synthetic peptide located within the following region: AGRVSAGSSKASSLPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRRGRLGA |
Rabbit Polyclonal Anti-CLASP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLASP2 antibody is: synthetic peptide directed towards the C-terminal region of Human CLASP2. Synthetic peptide located within the following region: VAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS |
CLASP2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human CLASP2 |
CLASP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CLASP2 |
CLASP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-400 of human CLASP2 (NP_001193973.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
