Antibodies

Jump to Filters
View as table Download
Claudin 23 (CLDN23) Rabbit Polyclonal Antibody
TA349284

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CLDN23
Claudin 23 (CLDN23) Rabbit Polyclonal Antibody
TA334206

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE
Claudin 23 (CLDN23) (C-term) Rabbit Polyclonal Antibody
AP50948PU-N

USD 450.00

2 Weeks

Claudin 23 (CLDN23) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 235~265 amino acids from the C-terminal region of human CLDN23
CLDN23 Rabbit Polyclonal Antibody
TA368786

USD 380.00

4 Weeks

CLDN23 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CLDN23