Antibodies

Jump to Filters
View as table Download
Claudin 9 (CLDN9) Rabbit Polyclonal Antibody
TA334197

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-CLDN9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN9 antibody: synthetic peptide directed towards the C terminal of human CLDN9. Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV