Rabbit Polyclonal Anti-CLEC3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLEC3A Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC3A. Synthetic peptide located within the following region: GKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKR |
Rabbit Polyclonal Anti-CLEC3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLEC3A Antibody is: synthetic peptide directed towards the N-terminal region of Human CLEC3A. Synthetic peptide located within the following region: GLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTE |
Germany
Japan
United Kingdom
China